Emticicia oligotrophica: Emtol_3519 Help Entry Emtol_3519        CDS       T02272                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism eol  Emticicia oligotrophica Pathway eol00261   Monobactam biosynthesis eol01100   Metabolic pathways eol01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:eol00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Emtol_3519  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:eol01008]     Emtol_3519 Polyketide biosynthesis proteins [BR:eol01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Emtol_3519 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFK04647 LinkDB All DBs Position complement(3859820..3860023) Genome browser AA seq 67 aa AA seqDB search MDYEDEILYKVLVNHEEQYSIWPVVRENPLGWKDIGKTGTKKECLEYIEQAWTDMSPLSL RKKMGGF NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggactacgaagacgaaattctttataaggttttagtaaaccacgaagaacaatatagt atttggcctgttgttagagaaaaccctttaggctggaaagatataggtaaaactggaaca aaaaaagagtgtcttgagtatattgagcaagcttggactgatatgagtcctctttcgctc agaaaaaaaatggggggattctga

DBGET integrated database retrieval system