Erwinia persicina: CI789_04435 Help Entry CI789_04435       CDS       T05618                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism epe  Erwinia persicina Pathway epe00261   Monobactam biosynthesis epe01100   Metabolic pathways epe01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:epe00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     CI789_04435  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:epe01008]     CI789_04435 Polyketide biosynthesis proteins [BR:epe01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     CI789_04435 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AXU94549 UniProt:  A0A3S5GT96 LinkDB All DBs Position complement(971753..971965) Genome browser AA seq 70 aa AA seqDB search MTEQLNPFDDESLDFLVLLNARQQYSLWPAFSDVPAGWQTVAGPTTRVACIAYIEEHWQD MRPVGLNTAG NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgactgaacaactcaatcccttcgatgatgagagcctcgacttcctggtgctgctgaat gcgcgccagcagtacagcctgtggcctgctttttccgatgtgcctgccggctggcagacc gtggccggcccgacgacgcgtgtggcctgtatcgcctatatcgaagaacactggcaggac atgcgcccggtcgggttgaatacggcgggttaa

DBGET integrated database retrieval system