Eleftheria terrae: N7L95_01125 Help Entry N7L95_01125       CDS       T09184                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism etb  Eleftheria terrae Pathway etb00261   Monobactam biosynthesis etb01100   Metabolic pathways etb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:etb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     N7L95_01125  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:etb01008]     N7L95_01125 Polyketide biosynthesis proteins [BR:etb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     N7L95_01125 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WKB53038 LinkDB All DBs Position complement(149858..150082) Genome browser AA seq 74 aa AA seqDB search MSHAFDSHDDQASFLVLVNRDNQHSLWPGYAGLPAGWRAVHGPGTRQDCLRYVERHWSDM RPASVARGSPAPPQ NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgagccacgccttcgacagccatgacgaccaggccagcttcctggtactggtcaaccgt gacaaccagcattcgctgtggccgggctatgccggcctgccggccggttggcgtgccgtg cacggtccgggcacgcgacaggattgcctgaggtatgtcgagcggcactggagcgacatg cggccggccagcgtggcgcgcggctcgccggcgccgccgcaatag

DBGET integrated database retrieval system