Eleftheria terrae: N7L95_29610 Help Entry N7L95_29610       CDS       T09184                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism etb  Eleftheria terrae Pathway etb00261   Monobactam biosynthesis etb01100   Metabolic pathways etb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:etb00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     N7L95_29610  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:etb01008]     N7L95_29610 Polyketide biosynthesis proteins [BR:etb01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     N7L95_29610 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WKB56199 LinkDB All DBs Position unnamed2:702443..702679 Genome browser AA seq 78 aa AA seqDB search MSFDDDNTIFRVVVNHEEQYSIWPDYRQVPDGWREAGKTGSKAECLAYINEVWTDMRPLS LRRQMEAAESGAVAGVGP NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagctttgacgacgacaacacgatcttccgcgtggtggtcaaccatgaggagcagtac tcgatctggccggactaccggcaggtgccagacggctggcgggaggcgggcaagaccggc agcaaggccgagtgcctggcctacatcaacgaggtgtggaccgacatgcgtccgctgagc ttgcgccggcagatggaggccgcggagtccggcgcagtggcgggcgtcggtccctga

DBGET integrated database retrieval system