Emergencia timonensis: CE91St48_06350 Help Entry CE91St48_06350    CDS       T08071                                  Name (GenBank) 4Fe-4S ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism etm  Emergencia timonensis Pathway etm00020   Citrate cycle (TCA cycle) etm01100   Metabolic pathways etm01110   Biosynthesis of secondary metabolites etm01120   Microbial metabolism in diverse environments etm01200   Carbon metabolism etm01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:etm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     CE91St48_06350 Enzymes [BR:etm01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      CE91St48_06350 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_7 Fer4 Fer4_10 Fer4_9 Fer4_2 Fer4_21 Fer4_6 Fer4_16 Fer4_8 Fer4_4 Fer4_17 Fer4_22 Fer4_3 Fer4_18 Fer4_13 ETF_QO Fer4_15 Motif Other DBs NCBI-ProteinID:  BDF07194 LinkDB All DBs Position 670422..670637 Genome browser AA seq 71 aa AA seqDB search MAKGKVEIRAESCKSCGYCVKFCPKNVLAIGDKVNSKGYQYVVAANPDDCIGCASCGVVC PDAAIEVYREV NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggcaaaaggaaaagtagaaattagagcagagagctgcaagagctgtggctattgcgtc aaattctgccctaaaaacgtactcgcaattggcgacaaagttaattcaaaaggctatcag tatgttgttgcggcaaatccggatgattgcatcggctgcgcttcatgcggtgtcgtatgt ccagacgcagcaattgaggtttatagggaggtttag

DBGET integrated database retrieval system