Eutrema salsugineum (saltwater cress): EUTSA_v10009269mg Help Entry EUTSA_v10009269mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus03020   RNA polymerase eus03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:eus00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     EUTSA_v10009269mg   09124 Replication and repair    03420 Nucleotide excision repair     EUTSA_v10009269mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:eus03021]     EUTSA_v10009269mg    03400 DNA repair and recombination proteins [BR:eus03400]     EUTSA_v10009269mg Transcription machinery [BR:eus03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      EUTSA_v10009269mg   RNA polymerase III system    RNA polymerase III      EUTSA_v10009269mg   RNA polymerase I system    RNA polymerase I      EUTSA_v10009269mg DNA repair and recombination proteins [BR:eus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       EUTSA_v10009269mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  18993734 NCBI-ProteinID:  XP_006417353 UniProt:  V4MUM0 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MIIPVRCFTCGKVIGNKWDAYLDLLQLDYTEGDALDALQLVRYCCRRMLMTHVDLIEKLL NYNTLEKSDNS NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgattatccctgttcgttgctttacatgtggaaaggtgattggaaacaagtgggatgcg tatcttgatcttctccagctagactacactgaaggggacgcacttgatgcgcttcagcta gtcagatactgctgcaggcgtatgctgatgactcatgttgatctgattgaaaagcttctc aactacaacactctggaaaaatcggacaacagttaa

DBGET integrated database retrieval system