Eutrema salsugineum (saltwater cress): EUTSA_v10011934mg Help Entry EUTSA_v10011934mg CDS       T02985                                  Name (RefSeq) hypothetical protein   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism eus  Eutrema salsugineum (saltwater cress) Pathway eus03020   RNA polymerase eus03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:eus00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     EUTSA_v10011934mg   09124 Replication and repair    03420 Nucleotide excision repair     EUTSA_v10011934mg  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:eus03021]     EUTSA_v10011934mg    03400 DNA repair and recombination proteins [BR:eus03400]     EUTSA_v10011934mg Transcription machinery [BR:eus03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      EUTSA_v10011934mg   RNA polymerase III system    RNA polymerase III      EUTSA_v10011934mg   RNA polymerase I system    RNA polymerase I      EUTSA_v10011934mg DNA repair and recombination proteins [BR:eus03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       EUTSA_v10011934mg BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DNA_RNApol_7kD YjdM_Zn_Ribbon DUF5816 HypA zinc_ribbon_13 DUF1451 zf-ribbon_3 OrfB_Zn_ribbon zinc_ribbon_10 A2L_zn_ribbon Zn-ribbon_8 Motif Other DBs NCBI-GeneID:  18010651 NCBI-ProteinID:  XP_006392763 UniProt:  V4JX83 LinkDB All DBs Position Unknown AA seq 51 aa AA seqDB search MDPQPEPVTYVCGDCGQENTLKSGDVIQCRECGYRILYKKRTRRVVQYEAR NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atggatccacagcccgaaccagttacttacgtctgcggagattgtggacaagagaacact ttgaagtctggggatgtgatccaatgccgagaatgtgggtaccgtattctatacaagaag cgcacccgtagagttgttcaatacgaagctcgctag

DBGET integrated database retrieval system