Eggerthella sp. YY7918: EGYY_13470 Help Entry EGYY_13470        CDS       T01566                                  Name (GenBank) ferredoxin 3   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism eyy  Eggerthella sp. YY7918 Pathway eyy00020   Citrate cycle (TCA cycle) eyy01100   Metabolic pathways eyy01110   Biosynthesis of secondary metabolites eyy01120   Microbial metabolism in diverse environments eyy01200   Carbon metabolism eyy01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:eyy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     EGYY_13470 Enzymes [BR:eyy01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      EGYY_13470 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_2 Fer4_9 Fer4_21 Fer4_10 Fer4_6 Fer4_16 Fer4_4 Fer4_22 Fer4_3 Fer4_15 Fer4_17 Fer4_8 Fer4_13 DUF3431 Fer4_18 Motif Other DBs NCBI-ProteinID:  BAK44499 UniProt:  F7V156 LinkDB All DBs Position 1472045..1472251 Genome browser AA seq 68 aa AA seqDB search MARIEVDDHFCKGCGLCVDACPVHIIELDHQRITAKGYHPARCTDDEACTGCMSCALMCP DVAITVER NT seq 207 nt NT seq  +upstreamnt  +downstreamnt atggccagaatcgaagtagacgatcatttctgcaaagggtgcggtctgtgtgtcgacgcg tgccccgtgcatataatcgagcttgatcaccagcgtattacggcgaagggatatcatccg gcgcggtgcaccgatgacgaggcgtgtacgggctgtatgtcgtgcgcgctcatgtgtccc gacgtggcaataacggttgagaggtag

DBGET integrated database retrieval system