Frankia alni: FRAAL2540 Help Entry FRAAL2540         CDS       T00384                                  Name (GenBank) MbtH protein   KO K05375   MbtH protein Organism fal  Frankia alni Pathway fal00261   Monobactam biosynthesis fal01100   Metabolic pathways fal01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fal00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FRAAL2540  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:fal01008]     FRAAL2540 Polyketide biosynthesis proteins [BR:fal01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FRAAL2540 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  CAJ61187 RhizoBase:  FRAAL2540 UniProt:  Q0RMR0 LinkDB All DBs Position 2760605..2760820 Genome browser AA seq 71 aa AA seqDB search MSTNPFDDENGRFYVVVNDEEQHSLWPVFVEVPAGWRVVFGEAARAECLEYVEQNWTDLR PKSLREAMSVD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt gtgagcacgaaccccttcgacgacgagaacggccgattctacgtcgtggtcaacgacgag gagcagcattccctctggccggtgttcgtcgaggtgcccgccggctggcgggtggtcttc ggtgaggcggcgcgggcggagtgcctggagtacgtcgaacagaactggaccgatctgcgg ccgaagagcctgcgtgaggccatgtcggtggattga

DBGET integrated database retrieval system