Fulmarus glacialis (Northern fulmar): 104078002 Help Entry 104078002         CDS       T08370                                  Name (RefSeq) ferritin heavy chain   KO K00522   ferritin heavy chain [EC:1.16.3.1] Organism fga  Fulmarus glacialis (Northern fulmar) Pathway fga00860   Porphyrin metabolism fga04216   Ferroptosis fga04217   Necroptosis Brite KEGG Orthology (KO) [BR:fga00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00860 Porphyrin metabolism     104078002  09140 Cellular Processes   09143 Cell growth and death    04216 Ferroptosis     104078002    04217 Necroptosis     104078002  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:fga04147]     104078002 Enzymes [BR:fga01000]  1. Oxidoreductases   1.16  Oxidizing metal ions    1.16.3  With oxygen as acceptor     1.16.3.1  ferroxidase      104078002 Exosome [BR:fga04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    104078002   Exosomal proteins of bladder cancer cells    104078002 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ferritin YppF Motif Other DBs NCBI-GeneID:  104078002 NCBI-ProteinID:  XP_009577742 LinkDB All DBs Position Unknown AA seq 113 aa AA seqDB search MKLQNQRGGRIFLQDVKKPDRDDWENGLTAMECALHLEKNVNQSLLELHKLATEKNDPHL CDFIETHYLDEQVKSIKELGDHVTNLRKMGAPKYGMAEYLFDKHTLGDSDNES NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaagctacaaaatcagaggggcggacgcatcttcttgcaggacgtcaagaagccagat cgtgatgactgggagaatggactgactgcaatggagtgtgccctgcacctggagaagaat gtgaaccagtcgctgttagaactgcacaaattggcaactgaaaagaatgacccgcatttg tgtgacttcattgagactcactacctggatgaacaggtgaagtccatcaaagagctgggc gaccatgtgaccaacctgcggaagatgggggcaccaaaatatggcatggcagagtacctc tttgacaagcacaccctaggggacagtgacaatgagagctga

DBGET integrated database retrieval system