Fusarium graminearum: FGSG_06683 Help Entry FGSG_06683        CDS       T01038                                  Name (RefSeq) DNA-directed RNA polymerases I   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism fgr  Fusarium graminearum Pathway fgr03020   RNA polymerase fgr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fgr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FGSG_06683   09124 Replication and repair    03420 Nucleotide excision repair     FGSG_06683  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fgr03021]     FGSG_06683    03400 DNA repair and recombination proteins [BR:fgr03400]     FGSG_06683 Transcription machinery [BR:fgr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FGSG_06683   RNA polymerase III system    RNA polymerase III      FGSG_06683   RNA polymerase I system    RNA polymerase I      FGSG_06683 DNA repair and recombination proteins [BR:fgr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FGSG_06683 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  23553805 NCBI-ProteinID:  XP_011326315 UniProt:  I1RRG3 LinkDB All DBs Position 4:complement(849441..850059) Genome browser AA seq 151 aa AA seqDB search MSDFDEGDVAGAGGDDAMYEDEEINDYYDPEPADDGENQQENQDDNIINSGDPSAIANAV KGGDRLLKDKKIPESERTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQIAI KEMREKKIPLIVRRYMPDGYYEDWTCEELLQ NT seq 456 nt NT seq  +upstreamnt  +downstreamnt atgtctgactttgatgaaggcgatgtggctggcgctggaggcgatgatgccatgtacgag gatgaggagatcaacgactactacgaccctgagcctgccgatgatggcgagaaccaacaa gagaaccaggacgacaacattatcaactctggagacccttctgctatcgcgaacgcggtg aagggcggcgatagactcctgaaagacaagaagatacccgagagcgagcgaaccacaaca ccctacatgaccaagtacgagagagcgcgtatcctcggcacacgcgctttgcagattagc atgaatgcgcctgtgcttgttgatctcgagggtgagacagatcccctgcagattgcgatc aaggagatgagggaaaagaaaattcccctgatcgtgcggcgctacatgcccgatggctac tacgaggactggacctgcgaggaactactgcagtaa

DBGET integrated database retrieval system