Fusarium keratoplasticum: NCS57_00634500 Help Entry NCS57_00634500    CDS       T09757                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism fkr  Fusarium keratoplasticum Pathway fkr03020   RNA polymerase fkr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fkr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     NCS57_00634500   09124 Replication and repair    03420 Nucleotide excision repair     NCS57_00634500  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fkr03021]     NCS57_00634500    03400 DNA repair and recombination proteins [BR:fkr03400]     NCS57_00634500 Transcription machinery [BR:fkr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      NCS57_00634500   RNA polymerase III system    RNA polymerase III      NCS57_00634500   RNA polymerase I system    RNA polymerase I      NCS57_00634500 DNA repair and recombination proteins [BR:fkr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       NCS57_00634500 BRITE hierarchy Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  77684611 NCBI-ProteinID:  XP_052915191 LinkDB All DBs Position 4:4239024..4239663 Genome browser AA seq 156 aa AA seqDB search MSDFGDDDVGGAGGDEPMYEDEEVTEYYDPEVVEEDEDGENRPQDGEDMDNVVVSGDPSA AANALKGGEKLLKDKKIPEGERTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDP LQIAIKEMREKKIPLIVRRYLPDGYYEDWTCEELLQ NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgtctgactttggtgatgatgatgttggtggcgctggcggtgacgagcccatgtacgag gacgaggaggttaccgagtactacgaccccgaggttgtcgaagaggatgaggatggcgag aaccgacctcaggatggcgaggatatggacaacgtcgttgtttctggagacccctctgcc gccgcgaacgcgctcaagggcggcgagaagctgctcaaagacaagaagatccccgagggc gagcgaaccacgacgccttacatgaccaagtacgagagggcgcgcatcctcggaacccgc gccctgcagatcagcatgaatgcgcccgtgcttgttgatctcgagggcgagacggacccc ctgcagattgccatcaaggagatgcgggagaagaagatccccttgatcgtgcgacgatac cttccggacggctactacgaggactggacctgcgaggaactgctgcagtga

DBGET integrated database retrieval system