Fomitiporia mediterranea: FOMMEDRAFT_94298 Help Entry FOMMEDRAFT_94298  CDS       T03132                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism fme  Fomitiporia mediterranea Pathway fme03020   RNA polymerase fme03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fme00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FOMMEDRAFT_94298   09124 Replication and repair    03420 Nucleotide excision repair     FOMMEDRAFT_94298  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fme03021]     FOMMEDRAFT_94298    03400 DNA repair and recombination proteins [BR:fme03400]     FOMMEDRAFT_94298 Transcription machinery [BR:fme03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FOMMEDRAFT_94298   RNA polymerase III system    RNA polymerase III      FOMMEDRAFT_94298   RNA polymerase I system    RNA polymerase I      FOMMEDRAFT_94298 DNA repair and recombination proteins [BR:fme03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FOMMEDRAFT_94298 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Motif Other DBs NCBI-GeneID:  18680742 NCBI-ProteinID:  XP_007270422 JGI:  Fomme1_94298 LinkDB All DBs Position Unknown AA seq 78 aa AA seqDB search IIPVRCFSCGKVVGDKWNEYMALLSQGISEGDVLDELQLKRYCCRRMVLTHVDLIEKLLH YNSACLTTVYFGKWMMFI NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atcattcctgtacgctgcttctcgtgcggtaaagtcgtgggcgacaaatggaacgagtac atggcattactctctcaaggaattagtgaaggtgacgtgctggatgaattgcagctaaaa cgatattgttgtcgacgtatggtcctgacacatgtcgacctgatcgagaaactgttgcat tataacagtgcgtgtcttacaacagtctactttggaaagtggatgatgtttatctaa

DBGET integrated database retrieval system