Fusarium musae: J7337_002349 Help Entry J7337_002349      CDS       T09538                                  Name (RefSeq) hypothetical protein   KO K03014   DNA-directed RNA polymerases I, II, and III subunit RPABC2 Organism fmu  Fusarium musae Pathway fmu03020   RNA polymerase fmu03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fmu00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     J7337_002349   09124 Replication and repair    03420 Nucleotide excision repair     J7337_002349  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fmu03021]     J7337_002349    03400 DNA repair and recombination proteins [BR:fmu03400]     J7337_002349 Transcription machinery [BR:fmu03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      J7337_002349   RNA polymerase III system    RNA polymerase III      J7337_002349   RNA polymerase I system    RNA polymerase I      J7337_002349 DNA repair and recombination proteins [BR:fmu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       J7337_002349 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb6 Motif Other DBs NCBI-GeneID:  68310206 NCBI-ProteinID:  XP_044684379 LinkDB All DBs Position 2:complement(1276139..1276672) Genome browser AA seq 142 aa AA seqDB search MSDFGDDDVGGAGGDEPMYEEEEITEYYDPEVLEEEDGDQQQNGQDQDNVVVSGDPSAAA NALKGGDKLLKDKKIPENERTTTPYMTKYERARILGTRALQISMNAPVLVDLEGETDPLQ IAIKEMREKKIPLIVRRYMPDG NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atgtctgatttcggcgatgacgatgttggcggcgctggcggcgacgagcccatgtacgag gaggaggagatcaccgagtactacgaccccgaggtcctcgaggaggaggatggtgaccag caacaaaacggacaagaccaggacaatgtcgtagtctcaggagatccttctgcagctgcc aacgcgctgaagggcggcgacaagctactcaaagacaagaagattcccgagaacgagcga actaccacaccctacatgaccaagtacgaaagggcacgcatcctcggtacacgcgctctg cagatcagcatgaatgcgcctgtgctagttgatctcgagggcgagactgatccgcttcaa atcgcgatcaaggagatgcgggaaaagaagatccccttgatcgtgcggcgatacatgccc gatggctag

DBGET integrated database retrieval system