Frankia casuarinae: Francci3_2451 Help Entry Francci3_2451     CDS       T00320                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism fra  Frankia casuarinae Pathway fra00261   Monobactam biosynthesis fra01100   Metabolic pathways fra01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fra00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Francci3_2451  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:fra01008]     Francci3_2451 Polyketide biosynthesis proteins [BR:fra01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Francci3_2451 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABD11818 RhizoBase:  Francci3_2451 UniProt:  Q2JA74 LinkDB All DBs Position complement(2859026..2859256) Genome browser AA seq 76 aa AA seqDB search MVMTNPFEDESASYFVLVNDEGQYSLWPVFAEVPGGWSIVHGEDSRKACLDFIEENWTDM RPKSLIAEMAEYETAD NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggtcatgaccaatcccttcgaggacgagtccgccagctatttcgtgctcgtcaacgac gaaggccagtattcgctctggccggtcttcgccgaggttccaggaggctggtccatcgtc cacggtgaggactccagaaaggcgtgcctggacttcatcgaggagaactggacggacatg cggcccaagagcctcatcgcggagatggcggagtacgagaccgccgactga

DBGET integrated database retrieval system