Parafrankia sp. EAN1pec: Franean1_3059 Help Entry Franean1_3059     CDS       T00608                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism fre  Parafrankia sp. EAN1pec Pathway fre00261   Monobactam biosynthesis fre01100   Metabolic pathways fre01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fre00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Franean1_3059  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:fre01008]     Franean1_3059 Polyketide biosynthesis proteins [BR:fre01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Franean1_3059 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ABW12471 RhizoBase:  Franean1_3059 UniProt:  A8LCX8 LinkDB All DBs Position complement(3598988..3599239) Genome browser AA seq 83 aa AA seqDB search MAKNPFDDEDGTFYALINHEEQYSLWPTFKPVPGGWTIVYGEPDGRPRQEVLDWIDQTWT DLRPKSLRDFIASHEVARAATGE NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atggcgaagaacccgttcgacgacgaggatggcacgttctacgcgctcatcaaccatgag gagcagtactcgctctggcccacgttcaagccggtgcccggcggctggaccatcgtctac ggcgagccggacggcagacccaggcaggaggtgctcgactggatcgaccagacttggacc gacctgaggcccaagtcgctgcgcgacttcattgccagccacgaagtcgcgagagctgcc acaggcgagtaa

DBGET integrated database retrieval system