Francisella sp. FSC1006: LO80_01270 Help Entry LO80_01270        CDS       T03403                                  Name (GenBank) diguanylate cyclase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism frf  Francisella sp. FSC1006 Pathway frf00790   Folate biosynthesis frf01100   Metabolic pathways frf01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:frf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LO80_01270 Enzymes [BR:frf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      LO80_01270  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      LO80_01270  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      LO80_01270 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  AIT08737 UniProt:  A0A097EME0 LinkDB All DBs Position 259994..260347 Genome browser AA seq 117 aa AA seqDB search MQQSLFLKSLEIYVSLGCSEEERTQKQMVKIDLELEFNQDYSASDTDNLEETICYYTLRN NIQKFCDDISCNLIEYLAKQIFLFIQDTHQDVKVKYLKLIKSPPVSQIESASFIIRS NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgcaacaatctttatttttaaaatctcttgaaatatatgtaagcttgggttgctcagaa gaagaaagaactcaaaaacaaatggttaaaattgatcttgaattagaatttaaccaagac tattccgcaagtgatacagataatcttgaagaaacaatttgttactatactttgagaaat aatatccaaaaattctgtgatgatattagttgtaaccttatagagtacttagctaagcaa atttttctatttatacaagatactcaccaagatgtaaaagttaaatatctgaaacttatc aagtcccctcctgtttcacaaatagagtcagcctcttttattattaggagttag

DBGET integrated database retrieval system