Pseudofrankia inefficax: FraEuI1c_4536 Help Entry FraEuI1c_4536     CDS       T01354                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism fri  Pseudofrankia inefficax Pathway fri00261   Monobactam biosynthesis fri01100   Metabolic pathways fri01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fri00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FraEuI1c_4536  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:fri01008]     FraEuI1c_4536 Polyketide biosynthesis proteins [BR:fri01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FraEuI1c_4536 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADP82529 UniProt:  E3IVM3 LinkDB All DBs Position complement(5566921..5567178) Genome browser AA seq 85 aa AA seqDB search MSTNPFDDEMGSFYVLVNAEGQHSLWPTFAPVPTGWTTAHGAASRSDCLEYVEAHWTDLR PASLIARMALATEGTRDGADSGASR NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgtcgaccaacccgttcgacgacgaaatgggcagcttctacgtcctggtcaacgccgag ggccaacactcgctgtggccgacgttcgcgccggtcccgaccggctggacaacggcgcac ggcgccgcgagccggtcggactgcctggagtacgtcgaggcccactggacggacctgcgg ccggccagcctgatcgcccggatggcgctcgccacggagggcacccgcgacggtgccgac tccggcgcgtcgcgatga

DBGET integrated database retrieval system