Candidatus Fervidibacter sacchari: Q2T83_12575 Help Entry Q2T83_12575       CDS       T09227                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fsh  Candidatus Fervidibacter sacchari Pathway fsh00020   Citrate cycle (TCA cycle) fsh01100   Metabolic pathways fsh01110   Biosynthesis of secondary metabolites fsh01120   Microbial metabolism in diverse environments fsh01200   Carbon metabolism fsh01210   2-Oxocarboxylic acid metabolism Module fsh_M00009   Citrate cycle (TCA cycle, Krebs cycle) fsh_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:fsh00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Q2T83_12575 Enzymes [BR:fsh01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Q2T83_12575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_21 Fer4 Fer4_7 Fer4_10 Fer4_2 Fer4_6 Fer4_9 Fer4_4 Fer4_16 Fer4_3 Fer4_13 Fer4_22 Fer4_8 Fer4_17 Fer4_18 Fer4_15 Motif Other DBs NCBI-ProteinID:  WKU15164 LinkDB All DBs Position 2718410..2718724 Genome browser AA seq 104 aa AA seqDB search MDLKRKPIVQPAHKVRGKVIIHEERCKGCGFCIEFCPKGVLAASPKFNSKGYHPPYAAKP EDCVNCNLCFLVCPEFAIYSIPADEREIRVVFAPSVPTTLAAGD NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggacctaaagcggaagccaatagtccaaccggctcacaaggttcgtgggaaagtgatc atccacgaagagcggtgcaagggatgcggtttttgcattgagttttgccccaagggagtg ttggcggcgtcgccaaagttcaactccaagggctaccatcccccatacgcggcaaaacct gaagattgcgtgaactgcaacttgtgcttcctcgtttgcccagagtttgctatttactcc atcccagccgatgaacgagagattcgcgtcgtctttgcgccttctgttcccacaactttg gctgcgggcgattga

DBGET integrated database retrieval system