Candidatus Protofrankia datiscae: FsymDg_0040 Help Entry FsymDg_0040       CDS       T01530                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism fsy  Candidatus Protofrankia datiscae Pathway fsy00261   Monobactam biosynthesis fsy01100   Metabolic pathways fsy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fsy00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     FsymDg_0040  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:fsy01008]     FsymDg_0040 Polyketide biosynthesis proteins [BR:fsy01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     FsymDg_0040 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEH07631 UniProt:  F8B101 LinkDB All DBs Position 71547..71768 Genome browser AA seq 73 aa AA seqDB search MTNPFEDPDGVYTVLVNAEGQYSLWPDFIDVPAGWTVEHGPGPRQECLDYIETYWTDMRP KSLIEAMEAATRD NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgaggatcccgacggcgtctacaccgtcctggtcaacgccgagggg cagtacagtctgtggccggacttcatcgacgtcccggccggctggacggtcgagcacggg ccgggcccgcgccaggagtgcctggactacatcgagacatactggacggatatgcgcccc aagagcctgatcgaggcaatggaagccgccacccgcgactga

DBGET integrated database retrieval system