Fusobacterium varium: FV113G1_27570 Help Entry FV113G1_27570     CDS       T05280                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fva  Fusobacterium varium Pathway fva00020   Citrate cycle (TCA cycle) fva01100   Metabolic pathways fva01110   Biosynthesis of secondary metabolites fva01120   Microbial metabolism in diverse environments fva01200   Carbon metabolism fva01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:fva00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     FV113G1_27570 Enzymes [BR:fva01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      FV113G1_27570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_2 Fer4_6 Fer4_9 Fer4_16 Fer4_10 Fer4_4 Fer4_22 Fer4_13 Fer4_8 Fer4_3 Fer4_17 Fer4_15 Fer4_18 Motif Other DBs NCBI-ProteinID:  BBA52406 LinkDB All DBs Position 3062042..3062257 Genome browser AA seq 71 aa AA seqDB search MTKIKLNFKTDICKGCGLCIEVCPLKVLKLNENAVNSKGYHPVYEFLENKCIACKSCALM CPDSVIMIEKL NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgactaaaattaaattaaactttaaaacagatatttgtaagggctgtggcctgtgtatt gaagtctgtcctctaaaagtattaaaacttaatgaaaatgcagttaattcaaaaggttat catcctgtatatgaatttttagaaaataaatgtatcgcttgtaaaagttgtgctttaatg tgtccagactctgttataatgattgaaaaattataa

DBGET integrated database retrieval system