Fusarium venenatum: FVRRES_07353 Help Entry FVRRES_07353      CDS       T09539                                  Name (RefSeq) uncharacterized protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism fvn  Fusarium venenatum Pathway fvn03020   RNA polymerase fvn03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fvn00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FVRRES_07353   09124 Replication and repair    03420 Nucleotide excision repair     FVRRES_07353  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fvn03021]     FVRRES_07353    03400 DNA repair and recombination proteins [BR:fvn03400]     FVRRES_07353 Transcription machinery [BR:fvn03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FVRRES_07353   RNA polymerase III system    RNA polymerase III      FVRRES_07353   RNA polymerase I system    RNA polymerase I      FVRRES_07353 DNA repair and recombination proteins [BR:fvn03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FVRRES_07353 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  37258992 NCBI-ProteinID:  XP_025586637 LinkDB All DBs Position II:complement(7601838..7602360) Genome browser AA seq 148 aa AA seqDB search MASGDATLFEESFTVMEYDQSKYDRVARISCTSADSQTVMSLDINIELFPCVPGDSLHVV LTTTLALDGSKEEEKGWRDVGKGGDAPATIADLYDYVCHGKIYKFEETFDGNTINAYVSF GGLLMSLQGPVKKLTPLRVDDVYLLVKK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggctagcggagatgccaccctctttgaggagtcctttaccgtaatggagtacgatcag tccaagtatgatcgtgtcgcacgtatctcttgcacatcggccgactcgcagaccgtcatg tcgcttgacatcaacattgagctgttcccatgtgtccccggtgactctttgcacgttgtt ttgacaacaacactggctctggatggaagcaaggaggaagagaagggctggcgggacgtt ggtaagggcggtgatgcgccagccacgattgccgacctctacgactatgtgtgccatggc aagatctacaagttcgaagagacattcgatggaaacaccatcaacgcttacgtctcgttc ggtggtctgctcatgtcgctccagggccctgtcaagaagttgactccgctccgcgtcgac gacgtctaccttcttgtcaagaaataa

DBGET integrated database retrieval system