Candidatus Formimonas warabiya: DCMF_10365 Help Entry DCMF_10365        CDS       T07208                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fwa  Candidatus Formimonas warabiya Pathway fwa00020   Citrate cycle (TCA cycle) fwa01100   Metabolic pathways fwa01110   Biosynthesis of secondary metabolites fwa01120   Microbial metabolism in diverse environments fwa01200   Carbon metabolism fwa01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:fwa00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DCMF_10365 Enzymes [BR:fwa01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DCMF_10365 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_10 Fer4_9 Fer4_2 Fer4_7 Fer4 Fer4_21 Fer4_6 Fer4_8 Fer4_17 Fer4_16 Fer4_13 Fer4_15 Motif Other DBs NCBI-ProteinID:  ATW28518 UniProt:  A0A3G1L1K8 LinkDB All DBs Position complement(2219786..2219983) Genome browser AA seq 65 aa AA seqDB search MEKKYIVHLTDRYCKACGICIGLCPKGVFTENYLGKAVIDHMDSCTGCKMCQFHCPDFCL EVAEA NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaaaatatatcgttcatctcacggatcgttattgcaaagcctgcgggatctgt atcgggctctgccccaaaggtgtttttacagaaaattatttaggcaaagcagtgattgat catatggactcgtgcaccggctgtaagatgtgccagttccattgccctgatttttgcctg gaggtggcagaagcatga

DBGET integrated database retrieval system