Candidatus Formimonas warabiya: DCMF_22705 Help Entry DCMF_22705        CDS       T07208                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fwa  Candidatus Formimonas warabiya Pathway fwa00020   Citrate cycle (TCA cycle) fwa01100   Metabolic pathways fwa01110   Biosynthesis of secondary metabolites fwa01120   Microbial metabolism in diverse environments fwa01200   Carbon metabolism fwa01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:fwa00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DCMF_22705 Enzymes [BR:fwa01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DCMF_22705 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_2 Fer4_7 Fer4_10 Fer4_21 Fer4_6 Fer4_16 Fer4_15 Fer4_13 Fer4_8 Fer4_22 Fer4_4 Motif Other DBs NCBI-ProteinID:  ATW27185 UniProt:  A0A3G1KRA7 LinkDB All DBs Position 4978481..4978684 Genome browser AA seq 67 aa AA seqDB search MKKYSVSVNEKHCKACGICIGLCPKGVFRENYLGKAVVEEADKCAGCKICALHCPDFCIE VGEDHDR NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgaaaaagtacagtgtcagtgtcaacgaaaaacactgtaaagcgtgcggtatctgtatc gggttgtgccctaaaggagtattccgggaaaactatctgggcaaagccgtagtagaagag gcggacaaatgtgcgggctgtaaaatctgcgccctccattgccccgacttttgcattgag gtaggtgaagatcatgaccggtaa

DBGET integrated database retrieval system