Candidatus Formimonas warabiya: DCMF_28360 Help Entry DCMF_28360        CDS       T07208                                  Name (GenBank) oxidoreductase   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism fwa  Candidatus Formimonas warabiya Pathway fwa00020   Citrate cycle (TCA cycle) fwa01100   Metabolic pathways fwa01110   Biosynthesis of secondary metabolites fwa01120   Microbial metabolism in diverse environments fwa01200   Carbon metabolism fwa01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:fwa00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     DCMF_28360 Enzymes [BR:fwa01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      DCMF_28360 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_10 Fer4_21 Fer4_16 Fer4_9 Fer4_4 Fer4_13 Fer4_15 Fer4_3 Fer4_17 Fer4_8 zf-MYND Fer4_18 Fer4_22 Motif Other DBs NCBI-ProteinID:  ATW28145 UniProt:  A0A3G1L0Y5 LinkDB All DBs Position 6283080..6283280 Genome browser AA seq 66 aa AA seqDB search MSQMILHRDRCKACRYCIKACPKNALSESDEFNKKGYQPVVVDEEKCVQCGSCYIICPDY VFEIAE NT seq 201 nt NT seq  +upstreamnt  +downstreamnt atgtctcaaatgattttacatagggacagatgcaaagcatgtcgttattgcatcaaggca tgcccgaaaaatgccctatcggagtcagacgaattcaataaaaagggctatcagcctgtt gttgtcgatgaagaaaaatgtgtccagtgcggctcttgttatattatttgcccggactat gtgtttgagattgccgaatag

DBGET integrated database retrieval system