Geoglobus acetivorans: GACE_1895 Help Entry GACE_1895         CDS       T03507                                  Name (GenBank) ferredoxin   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism gac  Geoglobus acetivorans Pathway gac00020   Citrate cycle (TCA cycle) gac00720   Carbon fixation pathways in prokaryotes gac01100   Metabolic pathways gac01110   Biosynthesis of secondary metabolites gac01120   Microbial metabolism in diverse environments gac01200   Carbon metabolism gac01210   2-Oxocarboxylic acid metabolism Module gac_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:gac00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     GACE_1895   09102 Energy metabolism    00720 Carbon fixation pathways in prokaryotes     GACE_1895 Enzymes [BR:gac01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      GACE_1895 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_6 Fer4_7 Fer4_2 Fer4 Fer4_9 Fer4_21 Fer4_10 Fer4_16 Fer4_8 Fer4_4 Fer4_22 Fer4_18 Fer4_3 Fer4_13 Motif Other DBs NCBI-ProteinID:  AIY90921 UniProt:  A0A0A7GJ28 LinkDB All DBs Position complement(1573194..1573418) Genome browser AA seq 74 aa AA seqDB search MFKVEFDARRCGGAGECIDVCDQGVWEWRMVEFNFLGRKFKKPMPFPVNQEKCIGCRKCE KICPTKCVSIVREA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgttcaaagtggaattcgatgcgaggagatgcggtggcgctggggagtgtattgatgtg tgtgatcagggcgtctgggagtggagaatggtcgagttcaacttccttggaaggaaattc aaaaagccgatgccattcccggtaaatcaggagaaatgcattggatgcaggaaatgtgag aaaatctgcccgacaaaatgcgtcagtattgtgagggaagcgtaa

DBGET integrated database retrieval system