Gilliamella apis: RAM11_05940 Help Entry RAM11_05940       CDS       T09380                                  Symbol folB Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gaq  Gilliamella apis Pathway gaq00790   Folate biosynthesis gaq01100   Metabolic pathways gaq01240   Biosynthesis of cofactors Module gaq_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:gaq00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     RAM11_05940 (folB) Enzymes [BR:gaq01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      RAM11_05940 (folB)  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      RAM11_05940 (folB)  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      RAM11_05940 (folB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB SYCP2_SLD Motif Other DBs NCBI-ProteinID:  WLT07668 LinkDB All DBs Position 1299874..1300242 Genome browser AA seq 122 aa AA seqDB search MTLTIKDRVFIESLTVYTTIGVYDWEKTIKQKLVLDLEMAWDNQPAGQSDNVKFCLDYFI VSQSITSFIEKNKFELIETVAERVAMLVIEQFSVQWLKIKVSKPDAIANAGNVAVLIERS AE NT seq 369 nt NT seq  +upstreamnt  +downstreamnt atgaccttaacaattaaagatagagtattcattgaatcactaaccgtttataccacaatt ggtgtttatgattgggaaaaaacgattaaacaaaagttagttcttgatcttgaaatggca tgggataatcaacctgctgggcaaagtgataatgtgaagttttgtttagactattttatt gtgtcgcaatcaataacgtcatttatagaaaaaaataaatttgagttgattgaaactgta gctgaacgtgtcgcaatgttagtcattgagcaattttcggtacaatggttgaaaataaaa gtgtcaaaacctgatgctattgctaatgctggtaacgttgcggtattaatagaacgtagc gctgaataa

DBGET integrated database retrieval system