Gordonia alkanivorans: C5O27_09180 Help Entry C5O27_09180       CDS       T05876                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism gav  Gordonia alkanivorans Pathway gav00261   Monobactam biosynthesis gav01100   Metabolic pathways gav01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gav00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C5O27_09180  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:gav01008]     C5O27_09180 Polyketide biosynthesis proteins [BR:gav01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C5O27_09180 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AZZ81209 UniProt:  A0A3T0UYI0 LinkDB All DBs Position 2063936..2064163 Genome browser AA seq 75 aa AA seqDB search MTNPFDDEDGRFYVLVNDENQHSLWPTFADIPAGWTKVFGEDSRAACLEYVEQNWTDLRP KSLIEAMEADKGAGS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccatttgatgacgaggacggccgcttctacgtgctcgtcaacgacgagaac cagcattcgctgtggccgacgttcgccgacatcccggctggttggaccaaggtgttcggc gaggacagtcgtgcggcgtgcctcgagtacgtcgaacagaactggaccgacctccgcccc aagagcctcatcgaggcgatggaagccgacaagggagcaggttcctga

DBGET integrated database retrieval system