Geobacillus sp. JS12: A0V43_15570 Help Entry A0V43_15570       CDS       T04412                                  Name (GenBank) dihydroneopterin aldolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gej  Geobacillus sp. JS12 Pathway gej00790   Folate biosynthesis gej01100   Metabolic pathways gej01240   Biosynthesis of cofactors Module gej_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:gej00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     A0V43_15570 Enzymes [BR:gej01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      A0V43_15570  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      A0V43_15570  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      A0V43_15570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB CclA_1 Motif Other DBs NCBI-ProteinID:  AMQ22049 UniProt:  A0A142D4U7 LinkDB All DBs Position 3177105..3177485 Genome browser AA seq 126 aa AA seqDB search MGRERAVIDKIYVQGMEFYGYHGVFREENILGQRFLVDVTLDLDLQPAGRSDCLEYTVNY ADVYERCRAIVEERTFALIEAVAEAIAADLLAAFPVVERCIVKVTKPNPPIRGHYQHVAV EIARGR NT seq 381 nt NT seq  +upstreamnt  +downstreamnt ttgggaagggagagagcggtcatcgataaaatttatgtgcaaggcatggagttttacggc taccacggggtgtttcgcgaagaaaacatccttggccagcgatttttggtcgatgtgacg ttggatctcgacttgcagcccgccgggcggagcgattgtcttgagtataccgtcaactac gccgatgtgtacgagcgctgccgggcgatcgttgaggagcggacgttcgccttgatcgag gcggtcgctgaagcgatcgccgccgacttgctcgctgcctttcctgttgtcgagcgctgc attgtcaaagtgacgaagccgaatccgccgattcgcggccattatcaacatgtcgcagtc gaaattgctaggggtcgttaa

DBGET integrated database retrieval system