Geomonas oryzisoli: KP004_06245 Help Entry KP004_06245       CDS       T07282                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ger  Geomonas oryzisoli Pathway ger00020   Citrate cycle (TCA cycle) ger01100   Metabolic pathways ger01110   Biosynthesis of secondary metabolites ger01120   Microbial metabolism in diverse environments ger01200   Carbon metabolism ger01210   2-Oxocarboxylic acid metabolism Module ger_M00009   Citrate cycle (TCA cycle, Krebs cycle) ger_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:ger00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     KP004_06245 Enzymes [BR:ger01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      KP004_06245 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_10 Fer4_21 Fer4_2 Fer4_7 Fer4_6 Fer4_16 Fer4_4 Fer4_8 Fer4_3 Fer4_17 Fer4_13 Fer4_18 Fer4_22 Motif Other DBs NCBI-ProteinID:  QWV94776 LinkDB All DBs Position 1410187..1410378 Genome browser AA seq 63 aa AA seqDB search MEKTPANIEIIEKYCKGCHICVEFCPTKVLEMKGFVASVKNLEACIKCMQCELRCPDFAI KVS NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggagaaaacaccggcgaacatcgagatcatcgagaagtactgcaaggggtgccacatc tgtgtggaattctgccccaccaaggtcttggaaatgaagggctttgtggctagcgtcaag aaccttgaggcctgcatcaagtgcatgcagtgcgagctgagatgccctgactttgcaatc aaagtatcgtaa

DBGET integrated database retrieval system