Geoalkalibacter halelectricus: L9S41_08155 Help Entry L9S41_08155       CDS       T09882                                  Name (GenBank) ferredoxin family protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism ghc  Geoalkalibacter halelectricus Pathway ghc00020   Citrate cycle (TCA cycle) ghc01100   Metabolic pathways ghc01110   Biosynthesis of secondary metabolites ghc01120   Microbial metabolism in diverse environments ghc01200   Carbon metabolism ghc01210   2-Oxocarboxylic acid metabolism Module ghc_M00009   Citrate cycle (TCA cycle, Krebs cycle) ghc_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:ghc00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     L9S41_08155 Enzymes [BR:ghc01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      L9S41_08155 BRITE hierarchy Motif Pfam:  Fer4 Fer4_7 Fer4_6 Fer4_2 Fer4_21 Fer4_10 Fer4_15 Fer4_9 Fer4_16 Fer4_4 Fer4_8 Fer4_17 Fer4_13 Fer4_3 DUF2865 Fer4_22 Motif Other DBs NCBI-ProteinID:  UWZ81352 LinkDB All DBs Position 1848208..1848432 Genome browser AA seq 74 aa AA seqDB search MAKLVIDESRCKGCALCTVACPHGLLQLRRTISRQGFFPVEIIPEKADRCTSCALCAQMC PDLAISVFREKKRG NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggccaaactcgttattgatgaatctcggtgcaagggttgcgcgctgtgtaccgtcgca tgcccccacgggttgctgcagttgcgccgcaccatcagtcggcagggattttttcccgtc gagatcattcccgaaaaggccgatcggtgcacctcctgcgccctctgcgcccagatgtgt cccgatctggccatcagcgtttttcgcgaaaagaaacgcggataa

DBGET integrated database retrieval system