Gossypium hirsutum (upland cotton): 3989239 Help Entry 3989239           CDS       T04793                                  Symbol ndhE, GohiCp074 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K05576   NAD(P)H-quinone oxidoreductase subunit 4L [EC:7.1.1.2] Organism ghi  Gossypium hirsutum (upland cotton) Pathway ghi00190   Oxidative phosphorylation ghi01100   Metabolic pathways Module ghi_M00145   NAD(P)H:quinone oxidoreductase, chloroplasts and cyanobacteria Brite KEGG Orthology (KO) [BR:ghi00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     3989239 (ndhE) Enzymes [BR:ghi01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      3989239 (ndhE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  3989239 NCBI-ProteinID:  YP_538988 UniProt:  Q2L957 H9LF13 LinkDB All DBs Position Pltd:125901..126206 Genome browser AA seq 101 aa AA seqDB search MMLEHILVLSAYLFSIGIYGLITSRNMVRALMCLELILNAVNINFVTFSDFFDSRQLKGN IFSIFVIAIAAAEAAIGSAIVSSIYRNRKSTRINQSTLLNK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgatgctcgaacatatacttgttttgagtgcctatttattttctatcggtatttatgga ttgatcacgagtcgaaatatggttagggcccttatgtgtcttgaacttatactgaatgcg gttaatataaattttgtaacattttctgatttttttgatagtcggcaattaaagggaaat attttctcaatttttgttatagctattgcagccgctgaagcagctattggatcagctatt gtgtcctcgatttatcgtaacagaaaatcaacgcgtatcaatcaatcaactttgttgaat aagtaa

DBGET integrated database retrieval system