Gordonia iterans: C6V83_16005 Help Entry C6V83_16005       CDS       T05370                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism git  Gordonia iterans Pathway git00261   Monobactam biosynthesis git01100   Metabolic pathways git01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:git00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     C6V83_16005  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:git01008]     C6V83_16005 Polyketide biosynthesis proteins [BR:git01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     C6V83_16005 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AVM01525 UniProt:  A0A2S0KIL6 LinkDB All DBs Position complement(3461439..3461675) Genome browser AA seq 78 aa AA seqDB search MTNPFDDENGRFYVLVNDENQHSLWPTFADIPAGWTKVFGEESRDACLKYVEENWTDLRP KSLIEAMERDAAERAAKE NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgacgaaccccttcgacgacgagaacggccgcttctacgtgctggtgaacgacgagaac cagcactcgctatggccgaccttcgccgacatcccggccggctggaccaaggtgttcggc gaggagagccgtgacgcgtgcctgaagtacgtggaggagaactggaccgacctgcgcccg aagagcctcatcgaggcgatggagcgcgatgccgcggagcgtgccgccaaggagtga

DBGET integrated database retrieval system