Geobacillus genomosp. 3: M493_00625 Help Entry M493_00625        CDS       T02798                                  Name (GenBank) dienelactone hydrolase   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gjf  Geobacillus genomosp. 3 Pathway gjf00790   Folate biosynthesis gjf01100   Metabolic pathways gjf01240   Biosynthesis of cofactors Module gjf_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:gjf00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     M493_00625 Enzymes [BR:gjf01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      M493_00625  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      M493_00625  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      M493_00625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB CclA_1 Motif Other DBs NCBI-ProteinID:  AGT30531 UniProt:  S5ZZI6 LinkDB All DBs Position 83364..83699 Genome browser AA seq 111 aa AA seqDB search MEFYGYHGAIPEENVLGQRFVVDVTLELDLRPAGRSDSLEHTVNYADVYERCRAIVEERT FALLEAVAEVIADELLAAFPAVQRCTVRVTKPNPPIRGHYGHVAVEIGRDR NT seq 336 nt NT seq  +upstreamnt  +downstreamnt atggaattttacggatatcatggagcgattccggaagaaaatgtgctcggccaacggttc gtggtggacgtgacgttagagctggatttgcggccagctgggcggagcgacagccttgaa catactgttaattacgcggatgtgtacgagcgttgtcgggcgatcgtagaagagcggacg tttgcgttgcttgaggcggtggctgaagtgattgcggacgagctgctcgccgctttcccc gccgtgcagcgctgtaccgtgagggtgacgaaaccgaatccaccaatccgcggacactac gggcatgttgccgttgaaatcggtagggatcgttaa

DBGET integrated database retrieval system