Giardia lamblia: GL50803_009509 Help Entry GL50803_009509    CDS       T01047                                  Name (RefSeq) RNA polymerase II subunit Rpb12   KO K03009   DNA-directed RNA polymerases I, II, and III subunit RPABC4 Organism gla  Giardia lamblia Pathway gla03020   RNA polymerase gla03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gla00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     GL50803_009509   09124 Replication and repair    03420 Nucleotide excision repair     GL50803_009509  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:gla03021]     GL50803_009509    03400 DNA repair and recombination proteins [BR:gla03400]     GL50803_009509 Transcription machinery [BR:gla03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      GL50803_009509   RNA polymerase III system    RNA polymerase III      GL50803_009509   RNA polymerase I system    RNA polymerase I      GL50803_009509 DNA repair and recombination proteins [BR:gla03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       GL50803_009509 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_RNApol_7kD Motif Other DBs NCBI-GeneID:  5698800 NCBI-ProteinID:  XP_001705915 UniProt:  E2RU91 Q8MUU3 LinkDB All DBs Position 2:complement(1426485..1426649) Genome browser AA seq 54 aa AA seqDB search MEPAGENQPVVYICATCGCETNPHMDGTIHCNTNPNHKVLYKKRASRPLVYKAI NT seq 165 nt NT seq  +upstreamnt  +downstreamnt atggagccagctggggaaaatcagcctgtcgtctatatctgtgctacatgcggttgcgag acgaacccgcacatggacggaacaatacattgcaacacaaaccctaatcacaaggttttg tacaagaagcgagcgtcgcggcccctcgtctacaaagcaatctag

DBGET integrated database retrieval system