Gloeocapsa sp. PCC 7428: Glo7428_1778 Help Entry Glo7428_1778      CDS       T02400                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism glp  Gloeocapsa sp. PCC 7428 Pathway glp00261   Monobactam biosynthesis glp01100   Metabolic pathways glp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:glp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Glo7428_1778  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:glp01008]     Glo7428_1778 Polyketide biosynthesis proteins [BR:glp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Glo7428_1778 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFZ30333 UniProt:  K9XCV6 LinkDB All DBs Position 2022615..2022836 Genome browser AA seq 73 aa AA seqDB search MNNVDTEDQTIYKVVVNHEEQYSIWPADRENALGWRDAGKSGLKSECLEYIKEVWTDMKP LSLRKGSTQNVST NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgaataacgttgatacagaagaccaaactatttataaagttgtggttaatcatgaagaa cagtattctatctggcctgctgatagagaaaatgctcttggttggagagatgcaggtaaa agtgggctgaaatcagaatgtttggaatacattaaagaagtatggactgatatgaaaccg ctaagtttgcgaaagggtagtactcaaaacgtctctacttag

DBGET integrated database retrieval system