Gloeocapsa sp. PCC 7428: Glo7428_4889 Help Entry Glo7428_4889      CDS       T02400                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism glp  Gloeocapsa sp. PCC 7428 Pathway glp00261   Monobactam biosynthesis glp01100   Metabolic pathways glp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:glp00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     Glo7428_4889  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:glp01008]     Glo7428_4889 Polyketide biosynthesis proteins [BR:glp01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     Glo7428_4889 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Glyco_hydro_72 Motif Other DBs NCBI-ProteinID:  AFZ33312 UniProt:  K9XNN7 LinkDB All DBs Position pGLO7428.01:32466..32684 Genome browser AA seq 72 aa AA seqDB search MMNQEDTEDTTIYTVVVNDEEQYSIWPEYREIPYGWKAAGKTGLKHECLEYIKEVWTDMR PLSLRKKMSEAN NT seq 219 nt NT seq  +upstreamnt  +downstreamnt atgatgaatcaagaagacaccgaagatactacgatttacaccgtagtcgttaatgacgaa gagcaatattcaatttggcctgagtaccgagaaattccctatggatggaaagcagcagga aaaacaggattaaaacacgaatgtctggaatacatcaaagaagtatggacagatatgcga cctttaagtttacgcaagaaaatgagcgaggctaattaa

DBGET integrated database retrieval system