Granulicella mallensis: AciX8_1981 Help Entry AciX8_1981        CDS       T01664                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism gma  Granulicella mallensis Pathway gma00261   Monobactam biosynthesis gma01100   Metabolic pathways gma01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gma00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     AciX8_1981  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:gma01008]     AciX8_1981 Polyketide biosynthesis proteins [BR:gma01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     AciX8_1981 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AEU36311 UniProt:  G8NSW8 LinkDB All DBs Position 2347570..2347779 Genome browser AA seq 69 aa AA seqDB search MTNPFEDAEATYNVLINKEGFYSLWPAFAAVPAGWTICLIDKRQACLDYINTTWTDMRPL SLVCAPALN NT seq 210 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccatttgaagatgcagaagctacttataacgtgctcatcaataaagagggt ttctattctttgtggccggcgtttgcggcagttccggccggatggacgatctgcctgatc gataagcggcaggcctgcctggattacatcaatacgacctggacggacatgcgtcccctg agcctggtctgtgctccagccctgaactag

DBGET integrated database retrieval system