Geobacillus sp. Y4.1MC1: GY4MC1_0172 Help Entry GY4MC1_0172       CDS       T01348                                  Name (GenBank) MbtH domain protein   KO K05375   MbtH protein Organism gmc  Geobacillus sp. Y4.1MC1 Pathway gmc00261   Monobactam biosynthesis gmc01100   Metabolic pathways gmc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gmc00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GY4MC1_0172  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:gmc01008]     GY4MC1_0172 Polyketide biosynthesis proteins [BR:gmc01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GY4MC1_0172 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ADP73024 UniProt:  A0A7U3YBY3 LinkDB All DBs Position 193597..193836 Genome browser AA seq 79 aa AA seqDB search MTNPFENKEGTYLVLINDEGQYSLWPASIAIPPGWNIAFAENTRSACLDYINAHWIDMRP NSLKDGSLSKRDNDYSGVK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccttttgaaaataaagaaggcacctaccttgtattaatcaatgatgaaggc cagtattccctctggcctgcctctattgcgattccgcccggctggaatattgcttttgcg gaaaatacgcgttcagcatgcctggactatattaacgctcattggatagatatgaggcct aatagcctgaaagatggatcattgtcaaagcgtgacaatgattattcaggagtaaaatga

DBGET integrated database retrieval system