Gordonia mangrovi: NWF22_03370 Help Entry NWF22_03370       CDS       T08472                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism gmg  Gordonia mangrovi Pathway gmg00261   Monobactam biosynthesis gmg01100   Metabolic pathways gmg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gmg00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     NWF22_03370  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:gmg01008]     NWF22_03370 Polyketide biosynthesis proteins [BR:gmg01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     NWF22_03370 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UVF78910 LinkDB All DBs Position complement(718762..718995) Genome browser AA seq 77 aa AA seqDB search MTNPFDDENGRFYVLVNDENQHSLWPTFADIPAGWTKVFGEDSRAACLEYVEKNWTDLRP KSLIDAMEADRAERAAE NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaccaatccgttcgacgacgaaaacggccgcttctacgtcctggtgaacgacgagaac cagcattcgctgtggcccacgttcgccgacatcccggccggctggaccaaggtcttcggt gaggacagtcgggcggcctgcctggaatacgtcgagaagaactggaccgacctgcggccg aagagcctgatcgacgccatggaggcggaccgcgccgagcgcgccgccgagtga

DBGET integrated database retrieval system