Geomonas nitrogeniifigens: KP003_04905 Help Entry KP003_04905       CDS       T07937                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism gnt  Geomonas nitrogeniifigens Pathway gnt00020   Citrate cycle (TCA cycle) gnt01100   Metabolic pathways gnt01110   Biosynthesis of secondary metabolites gnt01120   Microbial metabolism in diverse environments gnt01200   Carbon metabolism gnt01210   2-Oxocarboxylic acid metabolism Module gnt_M00009   Citrate cycle (TCA cycle, Krebs cycle) gnt_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:gnt00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     KP003_04905 Enzymes [BR:gnt01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      KP003_04905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_9 Fer4_10 Fer4_21 Fer4_6 Fer4_15 Fer4_4 Fer4_8 Fer4_16 Fer4_13 Fer4_3 Fer4_17 Fer4_22 Motif Other DBs NCBI-ProteinID:  QXE87748 LinkDB All DBs Position 1121367..1121570 Genome browser AA seq 67 aa AA seqDB search MGRIVIDEMRCKGCGICTIACPKKLIRLCEKVNIQGYAPAEAPDLEQCTGCALCAEICPD VAITVFK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atggggagaattgtaatagacgaaatgcgctgcaaggggtgcggtatctgcaccattgcg tgcccgaagaagctgatcaggctttgcgagaaggtcaatatccaggggtatgctccggcc gaggctcccgatctggagcagtgtaccgggtgtgctctctgcgccgaaatctgtcccgat gttgccataaccgtgttcaaataa

DBGET integrated database retrieval system