Gluconobacter oxydans H24: B932_3521 Help Entry B932_3521         CDS       T02348                                  Name (GenBank) chorismate mutase   KO K04092   chorismate mutase [EC:5.4.99.5] Organism goh  Gluconobacter oxydans H24 Pathway goh00400   Phenylalanine, tyrosine and tryptophan biosynthesis goh01100   Metabolic pathways goh01110   Biosynthesis of secondary metabolites goh01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:goh00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     B932_3521 Enzymes [BR:goh01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      B932_3521 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 HTH_63 Motif Other DBs NCBI-ProteinID:  AFW03060 LinkDB All DBs Position 3580409..3580723 Genome browser AA seq 104 aa AA seqDB search MTSDSSSALAELERLRASIDNIDAALIHMLAERFRCTKAVGELKARSSLPAADPNREARQ IERLRQLARDAHLDPDFAEKFLAFVIREVIRHHEAIAAQTNGSH NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgacttctgacagctcttccgccctcgcagaacttgagcgcctgcgtgccagcatcgac aatatcgacgccgccctgattcatatgctggcagagcggttccgctgcaccaaggcagtt ggcgaactgaaggcgcgttccagccttcccgccgcagaccctaaccgtgaagcccggcag atcgaacgcctgcgccagcttgcacgagacgctcatcttgatccggattttgctgaaaaa ttcctggctttcgtcatccgtgaggtcatccgtcatcacgaggccattgccgctcaaacc aacggttcgcactga

DBGET integrated database retrieval system