Gordonia otitidis: LK459_16050 Help Entry LK459_16050       CDS       T07915                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism goi  Gordonia otitidis Pathway goi00261   Monobactam biosynthesis goi01100   Metabolic pathways goi01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:goi00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     LK459_16050  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:goi01008]     LK459_16050 Polyketide biosynthesis proteins [BR:goi01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     LK459_16050 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  UEA58098 LinkDB All DBs Position 3521660..3521917 Genome browser AA seq 85 aa AA seqDB search MTNPFDDENGRFFVLVNDENQHSLWPTFADIPAGWTKVFGEDSRAACLEYVEQNWTDLRP KSLIEAMEADKAAAQNSGGDDSAGQ NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgaccaaccccttcgacgacgagaacggtcgcttcttcgtgctggtcaacgacgagaac cagcactcgctctggccgacattcgccgacattcctgcaggctggaccaaggtgttcggc gaagactctcgcgctgcgtgcctggagtacgtcgaacagaactggaccgacctgcgaccc aagagtttgatcgaggcgatggaggccgacaaggccgctgcccagaactccggaggcgac gacagcgcaggacagtga

DBGET integrated database retrieval system