Geomonas paludis: M1B72_15555 Help Entry M1B72_15555       CDS       T08160                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism gpl  Geomonas paludis Pathway gpl00020   Citrate cycle (TCA cycle) gpl01100   Metabolic pathways gpl01110   Biosynthesis of secondary metabolites gpl01120   Microbial metabolism in diverse environments gpl01200   Carbon metabolism gpl01210   2-Oxocarboxylic acid metabolism Module gpl_M00009   Citrate cycle (TCA cycle, Krebs cycle) gpl_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:gpl00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     M1B72_15555 Enzymes [BR:gpl01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      M1B72_15555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_2 Fer4_7 Fer4_21 Fer4_10 Fer4_9 Fer4_6 Fer4_15 Fer4_4 Fer4_16 Fer4_13 Fer4_8 Fer4_3 Fer4_22 Fer4_17 CBP110 Motif Other DBs NCBI-ProteinID:  UPU34853 LinkDB All DBs Position complement(3669444..3669647) Genome browser AA seq 67 aa AA seqDB search MGRIVIDEMRCKGCGICTIACPKKLIRLCEKVNIQGYAPAEAPNQEQCTGCALCAEICPD VAITVFK NT seq 204 nt NT seq  +upstreamnt  +downstreamnt atgggtagaattgtaatagacgaaatgcgctgcaagggctgcggtatctgcaccattgct tgcccaaagaagctgatcaggctgtgcgagaaggtcaatatccagggttatgcaccggct gaggctcccaatcaggagcagtgcaccgggtgtgctctctgcgccgaaatctgtcccgac gttgccataacagtctttaagtaa

DBGET integrated database retrieval system