Gordonia polyisoprenivorans: GPOL_c35750 Help Entry GPOL_c35750       CDS       T01719                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism gpo  Gordonia polyisoprenivorans Pathway gpo00261   Monobactam biosynthesis gpo01100   Metabolic pathways gpo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gpo00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GPOL_c35750  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:gpo01008]     GPOL_c35750 Polyketide biosynthesis proteins [BR:gpo01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GPOL_c35750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  AFA74587 UniProt:  H6N124 LinkDB All DBs Position 4026311..4026565 Genome browser AA seq 84 aa AA seqDB search MTNPFDNTDGVFSVLVNHENQHSLWPDFAPIPQGWQQVYGPDGHDACLAYVEDNWRDMRP ASLIAAMGEAPDAHRTGRNQDGTA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgaccaacccgttcgacaacaccgacggggtcttctccgtcctggtcaaccacgagaac cagcattcgctgtggccggacttcgcgccgatcccgcaggggtggcagcaggtgtacggg cccgacggacacgacgcctgcctggcctacgtcgaggacaactggcgcgacatgcggccg gcgagcctgatcgccgcgatgggtgaggcgcccgacgcccaccgaaccgggaggaaccag gatgggacggcatag

DBGET integrated database retrieval system