Gordonia rubripertincta: GCWB2_18925 Help Entry GCWB2_18925       CDS       T05629                                  Name (GenBank) MbtH-like protein   KO K05375   MbtH protein Organism gru  Gordonia rubripertincta Pathway gru00261   Monobactam biosynthesis gru01100   Metabolic pathways gru01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gru00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     GCWB2_18925  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:gru01008]     GCWB2_18925 Polyketide biosynthesis proteins [BR:gru01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     GCWB2_18925 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  ASR04558 UniProt:  A0A222TN03 LinkDB All DBs Position complement(4115805..4116032) Genome browser AA seq 75 aa AA seqDB search MTNPFDDEDGRFYVLVNDENQHSLWPTFADIPAGWTKVFGEDSRAACLEYVEQNWTDLRP KSLIEAMEADRAAGS NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgacgaatccattcgacgacgaggacggccgcttctacgtactcgtcaacgacgagaac cagcactcgctgtggccgacgttcgccgacatcccggcgggctggacgaaggtcttcggt gaggacagccgtgccgcttgcctcgagtacgtcgagcagaactggaccgatctgcggccc aagagtctcatcgaggccatggaagccgacagggccgccggttcttga

DBGET integrated database retrieval system