Geoalkalibacter subterraneus: GSUB_06815 Help Entry GSUB_06815        CDS       T03585                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism gsb  Geoalkalibacter subterraneus Pathway gsb00020   Citrate cycle (TCA cycle) gsb01100   Metabolic pathways gsb01110   Biosynthesis of secondary metabolites gsb01120   Microbial metabolism in diverse environments gsb01200   Carbon metabolism gsb01210   2-Oxocarboxylic acid metabolism Module gsb_M00009   Citrate cycle (TCA cycle, Krebs cycle) gsb_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:gsb00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     GSUB_06815 Enzymes [BR:gsb01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      GSUB_06815 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_21 Fer4_10 Fer4_6 Fer4_2 Fer4_9 Fer4_17 Fer4_16 Fer4_15 Fer4_13 Fer4_4 Fer4_8 Fer4_3 Fer4_18 Motif Other DBs NCBI-ProteinID:  AJF06318 UniProt:  A0A0B5FG65 LinkDB All DBs Position 1495782..1496006 Genome browser AA seq 74 aa AA seqDB search MNQTVIDESRCKGCALCTIACPHGLLQLRKTINKQGFLPAEMIAGKEDQCTACALCAQMC PDLAIRVFREKKAS NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaaccagactgtcatcgatgaatcgcggtgcaaggggtgcgcgctgtgcactattgcc tgtccccacggtctgctgcagttgcgcaagaccatcaataaacagggttttctcccggcg gaaatgatcgctggcaaagaagatcaatgtactgcctgtgccctctgtgcccagatgtgc cccgatctcgccatccgcgttttccgtgaaaagaaagccagttga

DBGET integrated database retrieval system