Geomonas subterranea: KP001_09310 Help Entry KP001_09310       CDS       T07936                                  Name (GenBank) 4Fe-4S binding protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism gsub  Geomonas subterranea Pathway gsub00020   Citrate cycle (TCA cycle) gsub00720   Other carbon fixation pathways gsub01100   Metabolic pathways gsub01110   Biosynthesis of secondary metabolites gsub01120   Microbial metabolism in diverse environments gsub01200   Carbon metabolism gsub01210   2-Oxocarboxylic acid metabolism Module gsub_M00009   Citrate cycle (TCA cycle, Krebs cycle) gsub_M00011   Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate Brite KEGG Orthology (KO) [BR:gsub00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     KP001_09310   09102 Energy metabolism    00720 Other carbon fixation pathways     KP001_09310 Enzymes [BR:gsub01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      KP001_09310 SSDB OrthologParalogGFIT Motif Pfam:  Fer4 Fer4_9 Fer4_10 Fer4_21 Fer4_2 Fer4_7 Fer4_6 Fer4_16 Fer4_4 Fer4_8 Fer4_3 Fer4_17 Fer4_13 Fer4_18 LdpA_Fe-S-bd Fer4_22 NosR PDXDC1-like_cen Motif Other DBs NCBI-ProteinID:  QXE92695 UniProt:  A0ABX8LPR8 LinkDB All DBs Position complement(2146286..2146477) Genome browser AA seq 63 aa AA seqDB search MEKTPANIEIIEKYCKGCHICVEFCPTKVLEMKGFVASVKNLEACIKCMQCELRCPDFAI KVS NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atggagaaaacaccggcgaacatcgagatcatcgagaagtactgcaaggggtgccacatc tgtgtggaattctgccccaccaaggtcttggaaatgaagggctttgtagcaagcgtcaag aaccttgaggcctgcatcaagtgcatgcagtgcgagctgagatgccctgactttgcaatc aaagtatcgtaa

DBGET integrated database retrieval system