Guillardia theta: GUITHDRAFT_75411 Help Entry GUITHDRAFT_75411  CDS       T02925                                  Name (RefSeq) hypothetical protein   KO K03007   DNA-directed RNA polymerases I, II, and III subunit RPABC5 Organism gtt  Guillardia theta Pathway gtt03020   RNA polymerase gtt03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gtt00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     GUITHDRAFT_75411   09124 Replication and repair    03420 Nucleotide excision repair     GUITHDRAFT_75411  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:gtt03021]     GUITHDRAFT_75411    03400 DNA repair and recombination proteins [BR:gtt03400]     GUITHDRAFT_75411 Transcription machinery [BR:gtt03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      GUITHDRAFT_75411   RNA polymerase III system    RNA polymerase III      GUITHDRAFT_75411   RNA polymerase I system    RNA polymerase I      GUITHDRAFT_75411 DNA repair and recombination proteins [BR:gtt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       GUITHDRAFT_75411 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_N Chordopox_RPO7 Motif Other DBs NCBI-GeneID:  17297198 NCBI-ProteinID:  XP_005827534 JGI:  Guith1_75411 UniProt:  L1IXE0 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MIIPIRCFTCNKTIGHMWRRYLEILENYDKEDGAEELGLKRYCCRRMLLTHVDLIEKLMV YNRKLLLACFL NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atgattattcctattcgatgctttacgtgtaacaagaccattgggcacatgtggcgaaga tacctcgaaatcctggaaaactacgataaggaagatggagccgaggagttggggctgaag cgatactgttgtcgaagaatgttgcttacacatgttgacttgatcgaaaagctcatggtt tacaaccgtaagttactgctcgcatgttttctgtag

DBGET integrated database retrieval system