Gloeobacter violaceus: glr1487 Help Entry glr1487           CDS       T00148                                  Name (GenBank) ORF_ID:glr1487   KO K01633   7,8-dihydroneopterin aldolase/epimerase/oxygenase [EC:4.1.2.25 5.1.99.8 1.13.11.81] Organism gvi  Gloeobacter violaceus Pathway gvi00790   Folate biosynthesis gvi01100   Metabolic pathways gvi01240   Biosynthesis of cofactors Brite KEGG Orthology (KO) [BR:gvi00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     glr1487 Enzymes [BR:gvi01000]  1. Oxidoreductases   1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)    1.13.11  With incorporation of two atoms of oxygen     1.13.11.81  7,8-dihydroneopterin oxygenase      glr1487  4. Lyases   4.1  Carbon-carbon lyases    4.1.2  Aldehyde-lyases     4.1.2.25  dihydroneopterin aldolase      glr1487  5. Isomerases   5.1  Racemases and epimerases    5.1.99  Acting on other compounds     5.1.99.8  7,8-dihydroneopterin epimerase      glr1487 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FolB Motif Other DBs NCBI-ProteinID:  BAC89428 UniProt:  Q7NKJ0 LinkDB All DBs Position 1596412..1596765 Genome browser AA seq 117 aa AA seqDB search MADCIRLREIVCYGYSGVYAEERRLGQRFIVDADLHIDLRTAGGSDRLEDSLDYGALVTA VRQIVEERQFSLLEALAEAIARRLRQDARVQQVRVVVAKPQPPIPGFTGSVAVEIWR NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atggctgattgcatccgtttgcgggagatcgtctgctacggctacagcggtgtgtatgcc gaggagcgccgcctcggccagcgcttcatcgtcgacgccgatctgcacatcgatctgcgt accgccggtggcagcgatcgcctcgaagacagcctcgactacggcgctctggtgacggcg gtgcggcagatcgtcgaagagcgccagttttcgctcctcgaagcactggccgaggcgatt gcccggcgcctgcgccaggatgcgcgcgtgcagcaggtacgcgtcgtcgtcgccaaaccc cagccgcccatccccggctttaccggcagcgtcgccgtcgagatctggcgctga

DBGET integrated database retrieval system